Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Rachel Sarah
2 product(s) found for "Rachel Sarah"
Beyond the Frame
Rachel Sarah
Beyond the Frame
Beyond the Frame - Endless layers of the Peruvian Andes extend beyond the reach of any eye, any camera. Image donated by Rachel Sarah.
£5.00
Units in Stock: 20
£5.00
Details
Add To Cart
Beyond the Frame - Endless layers of the Peruvian Andes extend beyond the reach of any eye, any camera. Image donated by Rachel Sarah.
The Island
Rachel Sarah
The Island
The Island - As we soar above the Peruvian Andes, an island emerges through the cloud. Image donated by Rachel Sarah.
£5.00
Units in Stock: 20
£5.00
Details
Add To Cart
The Island - As we soar above the Peruvian Andes, an island emerges through the cloud. Image donated by Rachel Sarah.
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i