Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
David Lintern
8 product(s) found for "David Lintern"
Ben Nevis and the Aonachs
David Lintern
Ben Nevis and the Aonachs
Ben Nevis and the Aonachs from the hill of the hind. Image donated by David Lintern.
£5.00
Units in Stock: 20
£5.00
Details
Add To Cart
Ben Nevis and the Aonachs from the hill of the hind. Image donated by David Lintern.
Stac Pollaidh
David Lintern
Stac Pollaidh
Stac Pollaidh from the Coigach hills. Image donated by David Lintern.
£5.00
Units in Stock: 24
£5.00
Details
Add To Cart
Stac Pollaidh from the Coigach hills. Image donated by David Lintern.
Creag Meagaidh
David Lintern
Creag Meagaidh
The cliffs of Creag Meagaidh. Image donated by David Lintern.
£5.00
Units in Stock: 25
£5.00
Details
Add To Cart
The cliffs of Creag Meagaidh. Image donated by David Lintern.
New Growth
David Lintern
New Growth
New Growth. Image donated by David Lintern.
£5.00
Units in Stock: 25
£5.00
Details
Add To Cart
New Growth. Image donated by David Lintern.
Old Growth
David Lintern
Old Growth
Old Growth. Image donated by David Lintern.
£5.00
Units in Stock: 25
£5.00
Details
Add To Cart
Old Growth. Image donated by David Lintern.
Site of the Battle of Ethand..
David Lintern
Site of the Battle of Ethand..
Site of the Battle of Ethandun, Wiltshire. Image donated by David Lintern.
£5.00
Units in Stock: 30
£5.00
Details
Add To Cart
Site of the Battle of Ethandun, Wiltshire. Image donated by David Lintern.
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i